PDAP1 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: PDAP1 enhances PDGFA-stimulated cell growth in fibroblasts, but inhibits the mitogenic effect of PDGFB.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PDAP1

Key Reference: Beausoleil,S.A., (2004) Proc. Natl. Acad. Sci. U.S.A. 101 (33), 12130-12135

Molecular Weight: 20kDa

Peptide Sequence: Synthetic peptide located within the following region: MPKGGRKGGHKGRARQYTSPEEIDAQLQAEKQKAREEEEQKEGGDGAAGD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: 28 kDa heat- and acid-stable phosphoprotein

Protein Size: 181

Purification: Affinity Purified

• SKU: AVIARP58790_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58790_P050-FITC
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 11333
• Host: Rabbit
• Conjugate: Conjugated, FITC