PDE4D Antibody - C-terminal region : HRP

PDE4D Antibody - C-terminal region : HRP
SKU
AVIARP56673_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes one of four mammalian counterparts to the fruit fly 'dunce' gene. The encoded protein has 3',5'-cyclic-AMP phosphodiesterase activity and degrades cAMP, which acts as a signal transduction molecule in multiple cell types. This gene uses different promoters to generate multiple alternatively spliced transcript variants that encode functional proteins.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human PDE4D

Molecular Weight: 55kDa

Peptide Sequence: Synthetic peptide located within the following region: FQFELTLEEDGESDTEKDSGSQVEEDTSCSDSKTLCTQDSESTEIPLDEQ

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: cAMP-specific 3',5'-cyclic phosphodiesterase 4D

Protein Size: 507

Purification: Affinity Purified
More Information
SKU AVIARP56673_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56673_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 5144
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×