PEA15 Antibody - C-terminal region : Biotin

PEA15 Antibody - C-terminal region : Biotin
SKU
AVIARP58923_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: PEA15 is a death effector domain (DED)-containing protein predominantly expressed in the central nervous system, particularly in astrocytes.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human PEA15

Molecular Weight: 15kDa

Peptide Sequence: Synthetic peptide located within the following region: DYRTRVLKISEEDELDTKLTRIPSAKKYKDIIRQPSEEEIIKLAPPPKKA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Astrocytic phosphoprotein PEA-15

Protein Size: 130

Purification: Affinity Purified
More Information
SKU AVIARP58923_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58923_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting, Immunohistochemistry
Human Gene ID 8682
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×