PENK Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: Met- and Leu-enkephalins compete with and mimic the effects of opiate drugs. They play a role in a number of physiologic functions, including pain perception and responses to stress. PENK (114-133) and PENK (237-258) increase glutamate release in the stri

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PENK

Key Reference: Nikoshkov,A., (2008) Proc. Natl. Acad. Sci. U.S.A. 105 (2), 786-791

Molecular Weight: 31kDa

Peptide Sequence: Synthetic peptide located within the following region: DAEEDDSLANSSDLLKELLETGDNRERSHHQDGSDNEEEVSKRYGGFMRG

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Proenkephalin-A

Protein Size: 267

Purification: Affinity Purified

• SKU: AVIARP56676_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56676_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 5179
• Host: Rabbit