PGLS Antibody - middle region : HRP

PGLS Antibody - middle region : HRP
SKU
AVIARP58513_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: PGLS belongs to the glucosamine/galactosamine-6-phosphate isomerase family, 6-phosphogluconolactonase subfamily. It is implicated in the hydrolysis of 6-phosphogluconolactone to 6-phosphogluconate.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PGLS

Key Reference: Miclet,E., (2001) J. Biol. Chem. 276 (37), 34840-34846

Molecular Weight: 28kDa

Peptide Sequence: Synthetic peptide located within the following region: AAVLKRILEDQEENPLPAALVQPHTGKLCWFLDEAAARLLTVPFEKHSTL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: 6-phosphogluconolactonase

Protein Size: 258

Purification: Affinity Purified
More Information
SKU AVIARP58513_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58513_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting, Immunohistochemistry
Human Gene ID 25796
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×