Phkg1 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Phkg1 is a catalytic subunit of phosphorylase kinase complex; It plays a role in glycogen metabolism.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Phkg1

Molecular Weight: 42kDa

Peptide Sequence: Synthetic peptide located within the following region: NFYENYEPKEILGRGVSSVVRRCIHKPTCQEYAVKIIDITGGGSFSSEEV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Phosphorylase b kinase gamma catalytic chain, skeletal muscle isoform

Protein Size: 388

Purification: Affinity Purified

• SKU: AVIARP56679_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56679_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 29353
• Host: Rabbit