Pi4k2b Antibody - N-terminal region : HRP

Pi4k2b Antibody - N-terminal region : HRP
SKU
AVIARP57203_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Together with PI4K2A and the type III PI4Ks (PIK4CA and PIK4CB) Pi4k2b contributes to the overall PI4-kinase activity of the cell. This contribution may be especially significant in plasma membrane, endosomal and Golgi compartments. The phosphorylation of phosphatidylinositol (PI) to PI4P is the first committed step in the generation of phosphatidylinositol 4,5-bisphosphate (PIP2), a precursor of the second messenger inositol 1,4,5-trisphosphate (InsP3). Pi4k2b contributes to the production of InsP3 in stimulated cells and is likely to be involved in the regulation of vesicular trafficking.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 52kDa

Peptide Sequence: Synthetic peptide located within the following region: EDPEFADIVLKAEQAIEIGVFPERISQGSSGSYFVKDSKRNIIGVFKPKS

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Phosphatidylinositol 4-kinase type 2-beta

Protein Size: 469

Purification: Affinity Purified
More Information
SKU AVIARP57203_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57203_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 67073
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×