PIN4 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a member of the parvulin subfamily of the peptidyl-prolyl cis/trans isomerase protein family. The encoded protein catalyzes the isomerization of peptidylprolyl bonds, and may play a role in the cell cycle, chromatin remodeling, and/or ri

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PIN4

Key Reference: Kessler,D., (er) BMC Biol. 5, 37 (2007)

Molecular Weight: 16kDa

Peptide Sequence: Synthetic peptide located within the following region: LGWMTRGSMVGPFQEAAFALPVSGMDKPVFTDPPVKTKFGYHIIMVEGRK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Peptidyl-prolyl cis-trans isomerase NIMA-interacting 4

Protein Size: 156

Purification: Affinity Purified

• SKU: AVIARP56688_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56688_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 5303
• Host: Rabbit