PNOC Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: Nociceptin is the ligand of the opioid receptor-like receptor (OPRL1). It may act as a transmitter in the brain by modulating nociceptive and locomotor behavior. PNOC may be involved in neuronal differentiation and development.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PNOC

Key Reference: Williams,J.P., (2008) Anesth. Analg. 106 (3), 865-866

Molecular Weight: 20kDa

Peptide Sequence: Synthetic peptide located within the following region: EQEEPEPGMEEAGEMEQKQLQKRFGGFTGARKSARKLANQKRFSEFMRQY

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Prepronociceptin

Protein Size: 176

Purification: Affinity Purified

• SKU: AVIARP56692_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56692_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 5368
• Host: Rabbit