PNPLA2 Antibody - middle region : HRP

PNPLA2 Antibody - middle region : HRP
SKU
AVIARP58938_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes an enzyme which catalyzes the first step in the hydrolysis of triglycerides in adipose tissue. Mutations in this gene are associated with neutral lipid storage disease with myopathy.

Molecular Weight: 55kDa

Peptide Sequence: Synthetic peptide located within the following region: RDGLRFLQRNGLLNRPNPLLALPPARPHGPEDKDQAVESAQAEDYSQLPG

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Patatin-like phospholipase domain-containing protein 2

Protein Size: 504

Purification: Affinity Purified
More Information
SKU AVIARP58938_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58938_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Western Blotting, Immunohistochemistry
Human Gene ID 57104
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×