PNPO Antibody - N-terminal region : FITC

PNPO Antibody - N-terminal region : FITC
SKU
AVIARP58515_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: PNPO catalyzes the terminal, rate-limiting step in the synthesis of pyridoxal 5'-phosphate, also known as vitamin B6. Vitamin B6 is a required co-factor for enzymes involved in both homocysteine metabolism and synthesis of neurotransmitters such as catecholamine.Vitamin B6, or pyridoxal 5-prime-phosphate (PLP), is critical for normal cellular function, and some cancer cells have notable differences in vitamin B6 metabolism compared to their normal counterparts. The rate-limiting enzyme in vitamin B6 synthesis is pyridoxine-5-prime-phosphate (PNP) oxidase (PNPO; EC 1.4.3.5).[supplied by OMIM].

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PNPO

Key Reference: Song,H., Schizophr. Res. 97 (1-3), 264-270 (2007)

Molecular Weight: 29kDa

Peptide Sequence: Synthetic peptide located within the following region: PMRKSYRGDREAFEETHLTSLDPVKQFAAWFEEAVQCPDIGEANAMCLAT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Pyridoxine-5'-phosphate oxidase

Protein Size: 261

Purification: Affinity Purified
More Information
SKU AVIARP58515_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58515_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 55163
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×