Ppp3cb Antibody - C-terminal region : Biotin

Ppp3cb Antibody - C-terminal region : Biotin
SKU
AVIARP57516_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: Ppp3cb is a Calcium-dependent, calmodulin-stimulated protein phosphatase. This subunit may have a role in the calmodulin activation of calcineurin.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 58kDa

Peptide Sequence: Synthetic peptide located within the following region: ESVLTLKGLTPTGMLPSGVLAGGRQTLQSATVEAIEAEKAIRGFSPPHRI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Serine/threonine-protein phosphatase 2B catalytic subunit beta isoform

Protein Size: 525

Purification: Affinity Purified

Subunit: beta isoform
More Information
SKU AVIARP57516_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57516_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 19056
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×