PRAP1 Antibody - C-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: PRAP1 may play an important role in maintaining normal growth homeostasis in epithelial cells.

Molecular Weight: 17kDa

Peptide Sequence: Synthetic peptide located within the following region: VLSPEPDHDSLYHPPPEEDQGEERPRLWVMPNHQVLLGPEEDQDHIYHPQ

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Proline-rich acidic protein 1

Protein Size: 151

Purification: Affinity Purified

Specificity#: Predicted reactivity to isoforms 1, 3, 4.

• SKU: AVIARP58517_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58517_P050-HRP
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Rat (Rattus), Pig (Porcine), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 118471
• Host: Rabbit
• Conjugate: Conjugated, HRP