Skip to the beginning of the images gallery

PrEST Antigen ARMH1

Name: PrEST Antigen ARMH1
Brand: Atlas Antibodies
SKU: ATLAPrEST95596-100

armadillo like helical domain containing 1

SKU

ATLAPrEST95596-100

Packaging Unit

100 µl

Manufacturer

Atlas Antibodies

Availability: loading...

Price is loading...

Product Details

More Information

GeneName: ARMH1

Sequence: EETQEEVQVLLDSLVHGNPKYQNQVYKGLIALLPCESPKAQQLSLQTLRTAQPIIGTTHPSIVDCVLK

Interspecies Mouse/Rat: ENSMUSG00000060268: 85%, ENSRNOG00000031494: 88%

Entrez Gene ID: 339541

UniProt ID: Q6PIY5

Buffer: PBS and 1M Urea, pH 7.4.

Ensembl Gene ID: ENSG00000198520

More Information
SKU	ATLAPrEST95596-100
Manufacturer	Atlas Antibodies
Manufacturer SKU	APrEST95596-100
Green Labware	No
Package Unit	100 µl
Quantity Unit	STK
Human Gene ID	339541
Product information (PDF)	Download
MSDS (PDF)	Download