Skip to the beginning of the images gallery

PrEST Antigen ASAP2

Name: PrEST Antigen ASAP2
Brand: Atlas Antibodies
SKU: ATLAPrEST95867-100

ArfGAP with SH3 domain, ankyrin repeat and PH domain 2

SKU

ATLAPrEST95867-100

Packaging Unit

100 µl

Manufacturer

Atlas Antibodies

Availability: loading...

Price is loading...

Product Details

More Information

GeneName: ASAP2

Sequence: WRLLHEDLDESDDDMDEKLQPSPNRREDRPISFYQLGSNQLQSNAVSLARDAANLAKDKQRAFMPSILQNETY

Interspecies Mouse/Rat: ENSMUSG00000052632: 89%, ENSRNOG00000061519: 88%

Entrez Gene ID: 8853

UniProt ID: O43150

Buffer: PBS and 1M Urea, pH 7.4.

Ensembl Gene ID: ENSG00000151693

More Information
SKU	ATLAPrEST95867-100
Manufacturer	Atlas Antibodies
Manufacturer SKU	APrEST95867-100
Green Labware	No
Package Unit	100 µl
Quantity Unit	STK
Human Gene ID	8853
Product information (PDF)	Download
MSDS (PDF)	Download