Skip to the beginning of the images gallery

PrEST Antigen C12orf60

Name: PrEST Antigen C12orf60
Brand: Atlas Antibodies
SKU: ATLAPrEST95965-100

chromosome 12 open reading frame 60

SKU

ATLAPrEST95965-100

Packaging Unit

100 µl

Manufacturer

Atlas Antibodies

Availability: loading...

Price is loading...

Product Details

More Information

GeneName: C12orf60

Sequence: EKDKERLIQAAKMFFFHVQDLASVINTLTELFSRSMNTQILLMAVKNNSYIKDFFEQMLRIFKEMQSVVDARHDKIQKESLCSKV

Interspecies Mouse/Rat: ENSMUSG00000047515: 66%, ENSRNOG00000027979: 58%

Entrez Gene ID: 144608

UniProt ID: Q5U649

Buffer: PBS and 1M Urea, pH 7.4.

Ensembl Gene ID: ENSG00000182993

More Information
SKU	ATLAPrEST95965-100
Manufacturer	Atlas Antibodies
Manufacturer SKU	APrEST95965-100
Green Labware	No
Package Unit	100 µl
Quantity Unit	STK
Human Gene ID	144608
Product information (PDF)	Download
MSDS (PDF)	Download