PrEST Antigen C15orf40

chromosome 15 open reading frame 40
SKU
ATLAPrEST96150-100
Packaging Unit
100 µl
Manufacturer
Atlas Antibodies

Availability: loading...
Price is loading...
Sequence: MPKKAGATTKGKSQSKEPERPLPPLGPVAVDPKGCVTIAIHAKPGSKQNAVTDLTAEAV

GeneName: C15orf40

Ensembl Gene ID: ENSG00000169609

UniProt ID: Q8WUR7

Entrez Gene ID: 123207

Buffer: PBS and 1M Urea, pH 7.4.

Interspecies Mouse/Rat: ENSMUSG00000025102: 78%, ENSRNOG00000052273: 81%

Atlas Antibodies attaches great importance to sustainability. In the production process of their high quality antibodies, Atlas follows the highest and most rigorous ethical animal welfare standards. The products are produced within Europe, which reduces the supply chain length to a minimum and WoolCool (100% natural sheep wool) is used as an insulating material instead of Styrofoam for the transportation of refrigerated goods.

More Information
SKU ATLAPrEST96150-100
Manufacturer Atlas Antibodies
Manufacturer SKU APrEST96150-100
Package Unit 100 µl
Quantity Unit STK
Human Gene ID 123207
Conjugate Unconjugated
Product information (PDF) Download
MSDS (PDF) Download