Skip to the beginning of the images gallery

PrEST Antigen C20orf96

Name: PrEST Antigen C20orf96
Brand: Atlas Antibodies
SKU: ATLAPrEST96112-100

chromosome 20 open reading frame 96

SKU

ATLAPrEST96112-100

Packaging Unit

100 µl

Manufacturer

Atlas Antibodies

Availability: loading...

Price is loading...

Product Details

More Information

GeneName: C20orf96

Sequence: KHSGTHSIVQEFQVPDYVPWQQSKQETKPSTLPPVQQANSLHTSKMKTLTRVQPVFHFKPTTVVTSCQPKNPRELHRRRKLDPGKMHAKIWLMKTSLRS

Interspecies Mouse/Rat: ENSMUSG00000032680: 32%, ENSRNOG00000023721: 31%

Entrez Gene ID: 140680

UniProt ID: Q9NUD7

Buffer: PBS and 1M Urea, pH 7.4.

Ensembl Gene ID: ENSG00000196476

More Information
SKU	ATLAPrEST96112-100
Manufacturer	Atlas Antibodies
Manufacturer SKU	APrEST96112-100
Green Labware	No
Package Unit	100 µl
Quantity Unit	STK
Human Gene ID	140680
Product information (PDF)	Download
MSDS (PDF)	Download