Skip to the beginning of the images gallery

PrEST Antigen CAD

Name: PrEST Antigen CAD
Brand: Atlas Antibodies
SKU: ATLAPrEST96125-100

carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase

SKU

ATLAPrEST96125-100

Packaging Unit

100 µl

Manufacturer

Atlas Antibodies

Availability: loading...

Price is loading...

Product Details

More Information

GeneName: CAD

Sequence: FSEATSSVQKGESLADSVQTMSCYADVVVLRHPQPGAVELAAKHCRRPVINAGDGVGEHPTQALLDIFTIREELGTVNGMTITMVGDLKHGRTVHSLACLLTQYRVSLRYVAPPSLRMPP

Interspecies Mouse/Rat: ENSMUSG00000013629: 99%, ENSRNOG00000026474: 99%

Entrez Gene ID: 790

UniProt ID: P27708

Buffer: PBS and 1M Urea, pH 7.4.

Ensembl Gene ID: ENSG00000084774

More Information
SKU	ATLAPrEST96125-100
Manufacturer	Atlas Antibodies
Manufacturer SKU	APrEST96125-100
Green Labware	No
Package Unit	100 µl
Quantity Unit	STK
Human Gene ID	790
Product information (PDF)	Download
MSDS (PDF)	Download