Skip to the beginning of the images gallery

PrEST Antigen CCR9

Name: PrEST Antigen CCR9
Brand: Atlas Antibodies
SKU: ATLAPrEST96133-100

C-C motif chemokine receptor 9

SKU

ATLAPrEST96133-100

Packaging Unit

100 µl

Manufacturer

Atlas Antibodies

Availability: loading...

Price is loading...

Product Details

More Information

GeneName: CCR9

Sequence: MADDYGSESTSSMEDYVNFNFTDFYCEKNNVRQFASHFL

Interspecies Mouse/Rat: ENSRNOG00000006311: 67%, ENSMUSG00000029530: 64%

Entrez Gene ID: 10803

UniProt ID: P51686

Buffer: PBS and 1M Urea, pH 7.4.

Ensembl Gene ID: ENSG00000173585

More Information
SKU	ATLAPrEST96133-100
Manufacturer	Atlas Antibodies
Manufacturer SKU	APrEST96133-100
Green Labware	No
Package Unit	100 µl
Quantity Unit	STK
Human Gene ID	10803
Product information (PDF)	Download
MSDS (PDF)	Download