Skip to the beginning of the images gallery

PrEST Antigen CNGA4

Name: PrEST Antigen CNGA4
Brand: Atlas Antibodies
SKU: ATLAPrEST95627-100

cyclic nucleotide gated channel subunit alpha 4

SKU

ATLAPrEST95627-100

Packaging Unit

100 µl

Manufacturer

Atlas Antibodies

Availability: loading...

Price is loading...

Product Details

More Information

GeneName: CNGA4

Sequence: LLAELESSALKIAYRIERLEWQTREWPMPEDLAEADDEGEPEEGTSKDEEGRAS

Interspecies Mouse/Rat: ENSMUSG00000030897: 83%, ENSRNOG00000017609: 87%

Entrez Gene ID: 1262

UniProt ID: Q8IV77

Buffer: PBS and 1M Urea, pH 7.4.

Ensembl Gene ID: ENSG00000132259

More Information
SKU	ATLAPrEST95627-100
Manufacturer	Atlas Antibodies
Manufacturer SKU	APrEST95627-100
Green Labware	No
Package Unit	100 µl
Quantity Unit	STK
Human Gene ID	1262
Product information (PDF)	Download
MSDS (PDF)	Download