Skip to the beginning of the images gallery

PrEST Antigen CREB3L1

Name: PrEST Antigen CREB3L1
Brand: Atlas Antibodies
SKU: ATLAPrEST96019-100

cAMP responsive element binding protein 3 like 1

SKU

ATLAPrEST96019-100

Packaging Unit

100 µl

Manufacturer

Atlas Antibodies

Availability: loading...

Price is loading...

Product Details

More Information

GeneName: CREB3L1

Sequence: MATTPLLGLSPLSRLPIPHQAPGEMTQLPVIKAEPLEVNQFLKVTPEDLVQMPPTP

Interspecies Mouse/Rat: ENSRNOG00000005413: 89%, ENSMUSG00000027230: 89%

Entrez Gene ID: 90993

UniProt ID: Q96BA8

Buffer: PBS and 1M Urea, pH 7.4.

Ensembl Gene ID: ENSG00000157613

More Information
SKU	ATLAPrEST96019-100
Manufacturer	Atlas Antibodies
Manufacturer SKU	APrEST96019-100
Green Labware	No
Package Unit	100 µl
Quantity Unit	STK
Human Gene ID	90993
Product information (PDF)	Download
MSDS (PDF)	Download