Skip to the beginning of the images gallery

PrEST Antigen CRLF2

Name: PrEST Antigen CRLF2
Brand: Atlas Antibodies
SKU: ATLAPrEST95938-100

cytokine receptor like factor 2

SKU

ATLAPrEST95938-100

Packaging Unit

100 µl

Manufacturer

Atlas Antibodies

Availability: loading...

Price is loading...

Product Details

More Information

GeneName: CRLF2

Sequence: YRSPFDTEWQSKQENTCNVTIEGLDAEKCYSFWVRVKAMEDVYGPDTYPSDWSEVTCWQRGEIRDACAETPTPPKPKLSK

Interspecies Mouse/Rat: ENSRNOG00000049828: 36%, ENSMUSG00000033467: 28%

Entrez Gene ID: 64109

UniProt ID: Q9HC73

Buffer: PBS and 1M Urea, pH 7.4.

Ensembl Gene ID: ENSG00000205755

More Information
SKU	ATLAPrEST95938-100
Manufacturer	Atlas Antibodies
Manufacturer SKU	APrEST95938-100
Green Labware	No
Package Unit	100 µl
Quantity Unit	STK
Human Gene ID	64109
Product information (PDF)	Download
MSDS (PDF)	Download