Skip to the beginning of the images gallery

PrEST Antigen EDIL3

Name: PrEST Antigen EDIL3
Brand: Atlas Antibodies
SKU: ATLAPrEST95553-100

EGF like repeats and discoidin domains 3

SKU

ATLAPrEST95553-100

Packaging Unit

100 µl

Manufacturer

Atlas Antibodies

Availability: loading...

Price is loading...

Product Details

More Information

GeneName: EDIL3

Sequence: QRKMRVTGVITQGAKRIGSPEYIKSYKIAYSNDGKTWAMYKVKGTNEDMVFRGNIDNNTPYANSFTPPIKAQYVRLYPQVCRRHCTLRMELLGCEL

Interspecies Mouse/Rat: ENSRNOG00000033064: 96%, ENSMUSG00000034488: 97%

Entrez Gene ID: 10085

UniProt ID: O43854

Buffer: PBS and 1M Urea, pH 7.4.

Ensembl Gene ID: ENSG00000164176

More Information
SKU	ATLAPrEST95553-100
Manufacturer	Atlas Antibodies
Manufacturer SKU	APrEST95553-100
Green Labware	No
Package Unit	100 µl
Quantity Unit	STK
Human Gene ID	10085
Product information (PDF)	Download
MSDS (PDF)	Download