Skip to the beginning of the images gallery

PrEST Antigen ERBB3

Name: PrEST Antigen ERBB3
Brand: Atlas Antibodies
SKU: ATLAPrEST95671-100

erb-b2 receptor tyrosine kinase 3

SKU

ATLAPrEST95671-100

Packaging Unit

100 µl

Manufacturer

Atlas Antibodies

Availability: loading...

Price is loading...

Product Details

More Information

GeneName: ERBB3

Sequence: PIMPTAGTTPDEDYEYMNRQRDGGGPGGDYAAMGACPASEQGYEEMRAFQGPGHQAPHVHYARLKTLRSLEATDSAFDNPDYWHSRLFPKANAQ

Interspecies Mouse/Rat: ENSRNOG00000004964: 89%, ENSMUSG00000018166: 90%

Entrez Gene ID: 2065

UniProt ID: P21860

Buffer: PBS and 1M Urea, pH 7.4.

Ensembl Gene ID: ENSG00000065361

More Information
SKU	ATLAPrEST95671-100
Manufacturer	Atlas Antibodies
Manufacturer SKU	APrEST95671-100
Green Labware	No
Package Unit	100 µl
Quantity Unit	STK
Human Gene ID	2065
Product information (PDF)	Download
MSDS (PDF)	Download