Skip to the beginning of the images gallery

PrEST Antigen FAM120C

Name: PrEST Antigen FAM120C
Brand: Atlas Antibodies
SKU: ATLAPrEST95866-100

family with sequence similarity 120C

SKU

ATLAPrEST95866-100

Packaging Unit

100 µl

Manufacturer

Atlas Antibodies

Availability: loading...

Price is loading...

Product Details

More Information

GeneName: FAM120C

Sequence: NWAVSYDSSASQFPNYLPSKASPPLGPDSSHSSSSDGDEPNGASSDHITEAFHHQPEWGNPNRDRGSWAQPVDTGVSEA

Interspecies Mouse/Rat: ENSRNOG00000062231: 71%, ENSMUSG00000025262: 73%

Entrez Gene ID: 54954

UniProt ID: Q9NX05

Buffer: PBS and 1M Urea, pH 7.4.

Ensembl Gene ID: ENSG00000184083

More Information
SKU	ATLAPrEST95866-100
Manufacturer	Atlas Antibodies
Manufacturer SKU	APrEST95866-100
Green Labware	No
Package Unit	100 µl
Quantity Unit	STK
Human Gene ID	54954
Product information (PDF)	Download
MSDS (PDF)	Download