Skip to the beginning of the images gallery

PrEST Antigen FAM186A

Name: PrEST Antigen FAM186A
Brand: Atlas Antibodies
SKU: ATLAPrEST96004-100

family with sequence similarity 186 member A

SKU

ATLAPrEST96004-100

Packaging Unit

100 µl

Manufacturer

Atlas Antibodies

Availability: loading...

Price is loading...

Product Details

More Information

GeneName: FAM186A

Sequence: DFKVAQVPFTTKKFQMSEVSDTSEETQILRDTFAIESFRTFQSHFTKYRTPVYQTPYTDERALLTLMKPTTSPSSLTTLLRT

Interspecies Mouse/Rat: ENSMUSG00000045350: 39%, ENSRNOG00000049592: 30%

Entrez Gene ID: 121006

UniProt ID: A6NE01

Buffer: PBS and 1M Urea, pH 7.4.

Ensembl Gene ID: ENSG00000185958

More Information
SKU	ATLAPrEST96004-100
Manufacturer	Atlas Antibodies
Manufacturer SKU	APrEST96004-100
Green Labware	No
Package Unit	100 µl
Quantity Unit	STK
Human Gene ID	121006
Product information (PDF)	Download
MSDS (PDF)	Download