Skip to the beginning of the images gallery

PrEST Antigen GRIA4

Name: PrEST Antigen GRIA4
Brand: Atlas Antibodies
SKU: ATLAPrEST95868-100

glutamate ionotropic receptor AMPA type subunit 4

SKU

ATLAPrEST95868-100

Packaging Unit

100 µl

Manufacturer

Atlas Antibodies

Availability: loading...

Price is loading...

Product Details

More Information

GeneName: GRIA4

Sequence: NGWHVSAICVENFNDVSYRQLLEELDRRQEKKFVIDCEIERLQNILEQIVSVGK

Interspecies Mouse/Rat: ENSMUSG00000025892: 100%, ENSRNOG00000006957: 100%

Entrez Gene ID: 2893

UniProt ID: P48058

Buffer: PBS and 1M Urea, pH 7.4.

Ensembl Gene ID: ENSG00000152578

More Information
SKU	ATLAPrEST95868-100
Manufacturer	Atlas Antibodies
Manufacturer SKU	APrEST95868-100
Green Labware	No
Package Unit	100 µl
Quantity Unit	STK
Human Gene ID	2893
Product information (PDF)	Download
MSDS (PDF)	Download