Skip to the beginning of the images gallery

PrEST Antigen HAND1

Name: PrEST Antigen HAND1
Brand: Atlas Antibodies
SKU: ATLAPrEST96052-100

heart and neural crest derivatives expressed 1

SKU

ATLAPrEST96052-100

Packaging Unit

100 µl

Manufacturer

Atlas Antibodies

Availability: loading...

Price is loading...

Product Details

More Information

GeneName: HAND1

Sequence: HPMLHEPFLFGPASRCHQERPYFQSWLLSPADAAPDFP

Interspecies Mouse/Rat: ENSMUSG00000037335: 100%, ENSRNOG00000002582: 100%

Entrez Gene ID: 9421

UniProt ID: O96004

Buffer: PBS and 1M Urea, pH 7.4.

Ensembl Gene ID: ENSG00000113196

More Information
SKU	ATLAPrEST96052-100
Manufacturer	Atlas Antibodies
Manufacturer SKU	APrEST96052-100
Green Labware	No
Package Unit	100 µl
Quantity Unit	STK
Human Gene ID	9421
Product information (PDF)	Download
MSDS (PDF)	Download