PrEST Antigen HAND1

heart and neural crest derivatives expressed 1

Sequence: HPMLHEPFLFGPASRCHQERPYFQSWLLSPADAAPDFP

GeneName: HAND1

Ensembl Gene ID: ENSG00000113196

UniProt ID: O96004

Entrez Gene ID: 9421

Buffer: PBS and 1M Urea, pH 7.4.

Interspecies Mouse/Rat: ENSMUSG00000037335: 100%, ENSRNOG00000002582: 100%

Atlas Antibodies attaches great importance to sustainability. In the production process of their high quality antibodies, Atlas follows the highest and most rigorous ethical animal welfare standards. The products are produced within Europe, which reduces the supply chain length to a minimum and WoolCool (100% natural sheep wool) is used as an insulating material instead of Styrofoam for the transportation of refrigerated goods.

• SKU: ATLAPrEST96052-100
• Manufacturer: Atlas Antibodies
• Manufacturer SKU: APrEST96052-100
• Package Unit: 100 µl
• Quantity Unit: STK
• Human Gene ID: 9421
• Conjugate: Unconjugated