Skip to the beginning of the images gallery

PrEST Antigen ILF2

Name: PrEST Antigen ILF2
Brand: Atlas Antibodies
SKU: ATLAPrEST95966-100

interleukin enhancer binding factor 2

SKU

ATLAPrEST95966-100

Packaging Unit

100 µl

Manufacturer

Atlas Antibodies

Availability: loading...

Price is loading...

Product Details

More Information

GeneName: ILF2

Sequence: PCESGNFRVHTVMTLEQQDMVCYTAQTLVRILSHGGFRKILGQEGDASYLASEISTWDGVIVTPSEKAYEKPPEKKE

Interspecies Mouse/Rat: ENSMUSG00000001016: 100%, ENSRNOG00000014154: 100%

Entrez Gene ID: 3608

UniProt ID: Q12905

Buffer: PBS and 1M Urea, pH 7.4.

Ensembl Gene ID: ENSG00000143621

More Information
SKU	ATLAPrEST95966-100
Manufacturer	Atlas Antibodies
Manufacturer SKU	APrEST95966-100
Green Labware	No
Package Unit	100 µl
Quantity Unit	STK
Human Gene ID	3608
Product information (PDF)	Download
MSDS (PDF)	Download