Skip to the beginning of the images gallery

PrEST Antigen LILRB3

Name: PrEST Antigen LILRB3
Brand: Atlas Antibodies
SKU: ATLAPrEST96134-100

leukocyte immunoglobulin like receptor B3

SKU

ATLAPrEST96134-100

Packaging Unit

100 µl

Manufacturer

Atlas Antibodies

Availability: loading...

Price is loading...

Product Details

More Information

GeneName: LILRB3

Sequence: CHYYSSAGWSEPSDPLELVMTGFYNKPTLSALPSPVVASGGNMTLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSGGFQALFPVGPVTPSHRWRFTCYYYYTNTPWVWSHPSDPLEILPS

Interspecies Mouse/Rat: ENSMUSG00000070873: 55%, ENSRNOG00000058087: 57%

Entrez Gene ID: 11025

UniProt ID: O75022

Buffer: PBS and 1M Urea, pH 7.4.

Ensembl Gene ID: ENSG00000204577

More Information
SKU	ATLAPrEST96134-100
Manufacturer	Atlas Antibodies
Manufacturer SKU	APrEST96134-100
Green Labware	No
Package Unit	100 µl
Quantity Unit	STK
Human Gene ID	11025
Product information (PDF)	Download
MSDS (PDF)	Download