Skip to the beginning of the images gallery

PrEST Antigen LRRC18

Name: PrEST Antigen LRRC18
Brand: Atlas Antibodies
SKU: ATLAPrEST95713-100

leucine rich repeat containing 18

SKU

ATLAPrEST95713-100

Packaging Unit

100 µl

Manufacturer

Atlas Antibodies

Availability: loading...

Price is loading...

Product Details

More Information

GeneName: LRRC18

Sequence: PVELKQLKNIRAVNLGLNHLDSVPTTLGALKELHEVGLHDNLLNNIPVSISKLPKLKKLNIKRNPFPKPGES

Interspecies Mouse/Rat: ENSMUSG00000041673: 88%, ENSRNOG00000020080: 89%

Entrez Gene ID: 474354

UniProt ID: Q8N456

Buffer: PBS and 1M Urea, pH 7.4.

Ensembl Gene ID: ENSG00000165383

More Information
SKU	ATLAPrEST95713-100
Manufacturer	Atlas Antibodies
Manufacturer SKU	APrEST95713-100
Green Labware	No
Package Unit	100 µl
Quantity Unit	STK
Human Gene ID	474354
Product information (PDF)	Download
MSDS (PDF)	Download