Skip to the beginning of the images gallery

PrEST Antigen MCF2L2

Name: PrEST Antigen MCF2L2
Brand: Atlas Antibodies
SKU: ATLAPrEST95865-100

MCF.2 cell line derived transforming sequence-like 2

SKU

ATLAPrEST95865-100

Packaging Unit

100 µl

Manufacturer

Atlas Antibodies

Availability: loading...

Price is loading...

Product Details

More Information

GeneName: MCF2L2

Sequence: MLSTEDLLMSHTRQRDKLQDELKLLGKQGTTLLSCIQEPATKCPNSKLNLNQLENVTTMERLLVQLDETEKAFSHFWSEHHLKLNQCLQLQHFEHDF

Interspecies Mouse/Rat: ENSRNOG00000028426: 42%, ENSMUSG00000031442: 43%

Entrez Gene ID: 23101

UniProt ID: Q86YR7

Buffer: PBS and 1M Urea, pH 7.4.

Ensembl Gene ID: ENSG00000053524

More Information
SKU	ATLAPrEST95865-100
Manufacturer	Atlas Antibodies
Manufacturer SKU	APrEST95865-100
Green Labware	No
Package Unit	100 µl
Quantity Unit	STK
Human Gene ID	23101
Product information (PDF)	Download
MSDS (PDF)	Download