Skip to the beginning of the images gallery

PrEST Antigen MUC13

Name: PrEST Antigen MUC13
Brand: Atlas Antibodies
SKU: ATLAPrEST96050-100

mucin 13, cell surface associated

SKU

ATLAPrEST96050-100

Packaging Unit

100 µl

Manufacturer

Atlas Antibodies

Availability: loading...

Price is loading...

Product Details

More Information

GeneName: MUC13

Sequence: CKKGKVFPGKISVTVSETFDPEEKHSMAYQDLHSEITSLFKDVFGTSVYGQTVILTVSTSLSPRSEMRADDKFVNVTI

Interspecies Mouse/Rat: ENSRNOG00000001794: 49%, ENSMUSG00000022824: 48%

Entrez Gene ID: 56667

UniProt ID: Q9H3R2

Buffer: PBS and 1M Urea, pH 7.4.

Ensembl Gene ID: ENSG00000173702

More Information
SKU	ATLAPrEST96050-100
Manufacturer	Atlas Antibodies
Manufacturer SKU	APrEST96050-100
Green Labware	No
Package Unit	100 µl
Quantity Unit	STK
Human Gene ID	56667
Product information (PDF)	Download
MSDS (PDF)	Download