Skip to the beginning of the images gallery

PrEST Antigen PAF1

Name: PrEST Antigen PAF1
Brand: Atlas Antibodies
SKU: ATLAPrEST96062-100

PAF1 homolog, Paf1/RNA polymerase II complex component

SKU

ATLAPrEST96062-100

Packaging Unit

100 µl

Manufacturer

Atlas Antibodies

Availability: loading...

Price is loading...

Product Details

More Information

GeneName: PAF1

Sequence: NSHRTLPERSGVVCRVKYCNSLPDIPFDPKFITYPFDQNRFVQYKATSLEKQHKHDLLTEPDLGVTIDLINPDTYRIDPNVL

Interspecies Mouse/Rat: ENSRNOG00000019746: 100%, ENSMUSG00000003437: 100%

Entrez Gene ID: 54623

UniProt ID: Q8N7H5

Buffer: PBS and 1M Urea, pH 7.4.

Ensembl Gene ID: ENSG00000006712

More Information
SKU	ATLAPrEST96062-100
Manufacturer	Atlas Antibodies
Manufacturer SKU	APrEST96062-100
Green Labware	No
Package Unit	100 µl
Quantity Unit	STK
Human Gene ID	54623
Product information (PDF)	Download
MSDS (PDF)	Download