Skip to the beginning of the images gallery

PrEST Antigen PBOV1

Name: PrEST Antigen PBOV1
Brand: Atlas Antibodies
SKU: ATLAPrEST95683-100

prostate and breast cancer overexpressed 1

SKU

ATLAPrEST95683-100

Packaging Unit

100 µl

Manufacturer

Atlas Antibodies

Availability: loading...

Price is loading...

Product Details

More Information

GeneName: PBOV1

Sequence: YSIEQSHHAILTPLQTHLTMKGSSMKCSSLSSEAILFT

Interspecies Mouse/Rat: ENSMUSG00000055717: 38%, ENSRNOG00000020425: 33%

Entrez Gene ID: 59351

UniProt ID: Q9GZY1

Buffer: PBS and 1M Urea, pH 7.4.

Ensembl Gene ID: ENSG00000254440

More Information
SKU	ATLAPrEST95683-100
Manufacturer	Atlas Antibodies
Manufacturer SKU	APrEST95683-100
Green Labware	No
Package Unit	100 µl
Quantity Unit	STK
Human Gene ID	59351
Product information (PDF)	Download
MSDS (PDF)	Download