Skip to the beginning of the images gallery

PrEST Antigen PIAS2

Name: PrEST Antigen PIAS2
Brand: Atlas Antibodies
SKU: ATLAPrEST96036-100

protein inhibitor of activated STAT 2

SKU

ATLAPrEST96036-100

Packaging Unit

100 µl

Manufacturer

Atlas Antibodies

Availability: loading...

Price is loading...

Product Details

More Information

GeneName: PIAS2

Sequence: MRPKKEAMKVSSQPCTKIESSSVLSKPCSVTVASEASKKKVDVI

Interspecies Mouse/Rat: ENSMUSG00000025423: 89%, ENSRNOG00000017493: 89%

Entrez Gene ID: 9063

UniProt ID: O75928

Buffer: PBS and 1M Urea, pH 7.4.

Ensembl Gene ID: ENSG00000078043

More Information
SKU	ATLAPrEST96036-100
Manufacturer	Atlas Antibodies
Manufacturer SKU	APrEST96036-100
Green Labware	No
Package Unit	100 µl
Quantity Unit	STK
Human Gene ID	9063
Product information (PDF)	Download
MSDS (PDF)	Download