Skip to the beginning of the images gallery

PrEST Antigen PPP1R3F

Name: PrEST Antigen PPP1R3F
Brand: Atlas Antibodies
SKU: ATLAPrEST95749-100

protein phosphatase 1 regulatory subunit 3F

SKU

ATLAPrEST95749-100

Packaging Unit

100 µl

Manufacturer

Atlas Antibodies

Availability: loading...

Price is loading...

Product Details

More Information

GeneName: PPP1R3F

Sequence: EVLQAPAIRIPPSSPLCGLGGSPRDQASGPDASEGATGPFLEPSQQQAEATWGVSSENGGGLEAVSGSEELLGEDTIDQELEQLYLSHLS

Interspecies Mouse/Rat: ENSMUSG00000039556: 65%, ENSRNOG00000058572: 28%

Entrez Gene ID: 89801

UniProt ID: Q6ZSY5

Buffer: PBS and 1M Urea, pH 7.4.

Ensembl Gene ID: ENSG00000049769

More Information
SKU	ATLAPrEST95749-100
Manufacturer	Atlas Antibodies
Manufacturer SKU	APrEST95749-100
Green Labware	No
Package Unit	100 µl
Quantity Unit	STK
Human Gene ID	89801
Product information (PDF)	Download
MSDS (PDF)	Download