Skip to the beginning of the images gallery

PrEST Antigen PPP6R2

Name: PrEST Antigen PPP6R2
Brand: Atlas Antibodies
SKU: ATLAPrEST95783-100

protein phosphatase 6 regulatory subunit 2

SKU

ATLAPrEST95783-100

Packaging Unit

100 µl

Manufacturer

Atlas Antibodies

Availability: loading...

Price is loading...

Product Details

More Information

GeneName: PPP6R2

Sequence: FDEPANSTPTAPGVVRDVGSSVWAAGTSAPEEKGWAKFTDFQPFCCSESGPRCSSPVDTECSHAEGSRSQGPEKASQASYFAVSPA

Interspecies Mouse/Rat: ENSMUSG00000036561: 63%, ENSRNOG00000026425: 64%

Entrez Gene ID: 9701

UniProt ID: O75170

Buffer: PBS and 1M Urea, pH 7.4.

Ensembl Gene ID: ENSG00000100239

More Information
SKU	ATLAPrEST95783-100
Manufacturer	Atlas Antibodies
Manufacturer SKU	APrEST95783-100
Green Labware	No
Package Unit	100 µl
Quantity Unit	STK
Human Gene ID	9701
Product information (PDF)	Download
MSDS (PDF)	Download