Skip to the beginning of the images gallery

PrEST Antigen RBM46

Name: PrEST Antigen RBM46
Brand: Atlas Antibodies
SKU: ATLAPrEST95630-100

RNA binding motif protein 46

SKU

ATLAPrEST95630-100

Packaging Unit

100 µl

Manufacturer

Atlas Antibodies

Availability: loading...

Price is loading...

Product Details

More Information

GeneName: RBM46

Sequence: QFTLLHLDYNFHRSSINSLSPVSATLSSGTPSVLPYTSRPYSYPGYPLSPTISLANGSHVGQRLCISNQ

Interspecies Mouse/Rat: ENSMUSG00000033882: 90%, ENSRNOG00000025823: 94%

Entrez Gene ID: 166863

UniProt ID: Q8TBY0

Buffer: PBS and 1M Urea, pH 7.4.

Ensembl Gene ID: ENSG00000151962

More Information
SKU	ATLAPrEST95630-100
Manufacturer	Atlas Antibodies
Manufacturer SKU	APrEST95630-100
Green Labware	No
Package Unit	100 µl
Quantity Unit	STK
Human Gene ID	166863
Product information (PDF)	Download
MSDS (PDF)	Download