Skip to the beginning of the images gallery

PrEST Antigen REPS1

Name: PrEST Antigen REPS1
Brand: Atlas Antibodies
SKU: ATLAPrEST95848-100

RALBP1 associated Eps domain containing 1

SKU

ATLAPrEST95848-100

Packaging Unit

100 µl

Manufacturer

Atlas Antibodies

Availability: loading...

Price is loading...

Product Details

More Information

GeneName: REPS1

Sequence: SKNEQESRHAASYSSDSENQGSYSGVIPPPPGRGQVKKGSVSHDTVQPRTSADAQEPASPVVSPQQSPPTSPHTWRKHSRHP

Interspecies Mouse/Rat: ENSRNOG00000059224: 85%, ENSMUSG00000019854: 90%

Entrez Gene ID: 85021

UniProt ID: Q96D71

Buffer: PBS and 1M Urea, pH 7.4.

Ensembl Gene ID: ENSG00000135597

More Information
SKU	ATLAPrEST95848-100
Manufacturer	Atlas Antibodies
Manufacturer SKU	APrEST95848-100
Green Labware	No
Package Unit	100 µl
Quantity Unit	STK
Human Gene ID	85021
Product information (PDF)	Download
MSDS (PDF)	Download