Skip to the beginning of the images gallery

PrEST Antigen RIT2

Name: PrEST Antigen RIT2
Brand: Atlas Antibodies
SKU: ATLAPrEST95990-100

Ras like without CAAX 2

SKU

ATLAPrEST95990-100

Packaging Unit

100 µl

Manufacturer

Atlas Antibodies

Availability: loading...

Price is loading...

Product Details

More Information

GeneName: RIT2

Sequence: LVREIRKKESMPSLMEKKLKRKDSLWKKLKGSLKKKR

Interspecies Mouse/Rat: ENSMUSG00000057455: 84%, ENSRNOG00000017568: 84%

Entrez Gene ID: 6014

UniProt ID: Q99578

Buffer: PBS and 1M Urea, pH 7.4.

Ensembl Gene ID: ENSG00000152214

More Information
SKU	ATLAPrEST95990-100
Manufacturer	Atlas Antibodies
Manufacturer SKU	APrEST95990-100
Green Labware	No
Package Unit	100 µl
Quantity Unit	STK
Human Gene ID	6014
Product information (PDF)	Download
MSDS (PDF)	Download