Skip to the beginning of the images gallery

PrEST Antigen SH3BP2

Name: PrEST Antigen SH3BP2
Brand: Atlas Antibodies
SKU: ATLAPrEST95983-100

SH3 domain binding protein 2

SKU

ATLAPrEST95983-100

Packaging Unit

100 µl

Manufacturer

Atlas Antibodies

Availability: loading...

Price is loading...

Product Details

More Information

GeneName: SH3BP2

Sequence: VPANKPKFLKIAEEDPPREAAMPGLFVPPVAPRPPALKLPVPEAMARPAVLPRPEKPQLPHLQRSPPDGQSFRSFSFEKPRQP

Interspecies Mouse/Rat: ENSRNOG00000013747: 76%, ENSMUSG00000054520: 78%

Entrez Gene ID: 6452

UniProt ID: P78314

Buffer: PBS and 1M Urea, pH 7.4.

Ensembl Gene ID: ENSG00000087266

More Information
SKU	ATLAPrEST95983-100
Manufacturer	Atlas Antibodies
Manufacturer SKU	APrEST95983-100
Green Labware	No
Package Unit	100 µl
Quantity Unit	STK
Human Gene ID	6452
Product information (PDF)	Download
MSDS (PDF)	Download