Skip to the beginning of the images gallery

PrEST Antigen SLC17A8

Name: PrEST Antigen SLC17A8
Brand: Atlas Antibodies
SKU: ATLAPrEST95925-100

solute carrier family 17 member 8

SKU

ATLAPrEST95925-100

Packaging Unit

100 µl

Manufacturer

Atlas Antibodies

Availability: loading...

Price is loading...

Product Details

More Information

GeneName: SLC17A8

Sequence: KAFDTFKEKILKPGKEGVKNAVGDSLGILQRKIDGTTEEEDNIELNEEGRPVQTSRPSPPLCDCHCCG

Interspecies Mouse/Rat: ENSRNOG00000007581: 84%, ENSMUSG00000019935: 90%

Entrez Gene ID: 246213

UniProt ID: Q8NDX2

Buffer: PBS and 1M Urea, pH 7.4.

Ensembl Gene ID: ENSG00000179520

More Information
SKU	ATLAPrEST95925-100
Manufacturer	Atlas Antibodies
Manufacturer SKU	APrEST95925-100
Green Labware	No
Package Unit	100 µl
Quantity Unit	STK
Human Gene ID	246213
Product information (PDF)	Download
MSDS (PDF)	Download