Skip to the beginning of the images gallery

PrEST Antigen SLC2A2

Name: PrEST Antigen SLC2A2
Brand: Atlas Antibodies
SKU: ATLAPrEST95914-100

solute carrier family 2 member 2

SKU

ATLAPrEST95914-100

Packaging Unit

100 µl

Manufacturer

Atlas Antibodies

Availability: loading...

Price is loading...

Product Details

More Information

GeneName: SLC2A2

Sequence: RLRGYDDVTKDINEMRKEREEASSEQKVSIIQLFTNSSYRQ

Interspecies Mouse/Rat: ENSRNOG00000011875: 80%, ENSMUSG00000027690: 78%

Entrez Gene ID: 6514

UniProt ID: P11168

Buffer: PBS and 1M Urea, pH 7.4.

Ensembl Gene ID: ENSG00000163581

More Information
SKU	ATLAPrEST95914-100
Manufacturer	Atlas Antibodies
Manufacturer SKU	APrEST95914-100
Green Labware	No
Package Unit	100 µl
Quantity Unit	STK
Human Gene ID	6514
Product information (PDF)	Download
MSDS (PDF)	Download