Skip to the beginning of the images gallery

PrEST Antigen SORCS2

Name: PrEST Antigen SORCS2
Brand: Atlas Antibodies
SKU: ATLAPrEST95790-100

sortilin related VPS10 domain containing receptor 2

SKU

ATLAPrEST95790-100

Packaging Unit

100 µl

Manufacturer

Atlas Antibodies

Availability: loading...

Price is loading...

Product Details

More Information

GeneName: SORCS2

Sequence: PSMDMNGKPTNCKPPDCHLHLHLRWADNPYVSGTVHTKDTAPGLIMGAGNLGSQLVEYKEEMYITSDCGHT

Interspecies Mouse/Rat: ENSRNOG00000007033: 97%, ENSMUSG00000029093: 96%

Entrez Gene ID: 57537

UniProt ID: Q96PQ0

Buffer: PBS and 1M Urea, pH 7.4.

Ensembl Gene ID: ENSG00000184985

More Information
SKU	ATLAPrEST95790-100
Manufacturer	Atlas Antibodies
Manufacturer SKU	APrEST95790-100
Green Labware	No
Package Unit	100 µl
Quantity Unit	STK
Human Gene ID	57537
Product information (PDF)	Download
MSDS (PDF)	Download