Skip to the beginning of the images gallery

PrEST Antigen SPTLC2

Name: PrEST Antigen SPTLC2
Brand: Atlas Antibodies
SKU: ATLAPrEST95785-100

serine palmitoyltransferase long chain base subunit 2

SKU

ATLAPrEST95785-100

Packaging Unit

100 µl

Manufacturer

Atlas Antibodies

Availability: loading...

Price is loading...

Product Details

More Information

GeneName: SPTLC2

Sequence: NYLGFARNTGSCQEAAAKVLEEYGAGVCSTRQEIGNLDKHEELEELVARFL

Interspecies Mouse/Rat: ENSRNOG00000012210: 92%, ENSMUSG00000021036: 94%

Entrez Gene ID: 9517

UniProt ID: O15270

Buffer: PBS and 1M Urea, pH 7.4.

Ensembl Gene ID: ENSG00000100596

More Information
SKU	ATLAPrEST95785-100
Manufacturer	Atlas Antibodies
Manufacturer SKU	APrEST95785-100
Green Labware	No
Package Unit	100 µl
Quantity Unit	STK
Human Gene ID	9517
Product information (PDF)	Download
MSDS (PDF)	Download