Skip to the beginning of the images gallery

PrEST Antigen TIAL1

Name: PrEST Antigen TIAL1
Brand: Atlas Antibodies
SKU: ATLAPrEST95996-100

TIA1 cytotoxic granule associated RNA binding protein like 1

SKU

ATLAPrEST95996-100

Packaging Unit

100 µl

Manufacturer

Atlas Antibodies

Availability: loading...

Price is loading...

Product Details

More Information

GeneName: TIAL1

Sequence: SPDMTKNFQQVDYSQWGQWSQVYGNPQQYGQYMANGW

Interspecies Mouse/Rat: ENSMUSG00000030846: 100%, ENSRNOG00000020271: 100%

Entrez Gene ID: 7073

UniProt ID: Q01085

Buffer: PBS and 1M Urea, pH 7.4.

Ensembl Gene ID: ENSG00000151923

More Information
SKU	ATLAPrEST95996-100
Manufacturer	Atlas Antibodies
Manufacturer SKU	APrEST95996-100
Green Labware	No
Package Unit	100 µl
Quantity Unit	STK
Human Gene ID	7073
Product information (PDF)	Download
MSDS (PDF)	Download