Skip to the beginning of the images gallery

PrEST Antigen UBA5

Name: PrEST Antigen UBA5
Brand: Atlas Antibodies
SKU: ATLAPrEST96098-100

ubiquitin like modifier activating enzyme 5

SKU

ATLAPrEST96098-100

Packaging Unit

100 µl

Manufacturer

Atlas Antibodies

Availability: loading...

Price is loading...

Product Details

More Information

GeneName: UBA5

Sequence: LERELAQERSLQVPRSGDGGGGRVRIEKMSSEVVDSNPYSRLMALKRMGIVSDYEK

Interspecies Mouse/Rat: ENSMUSG00000032557: 70%, ENSRNOG00000011027: 75%

Entrez Gene ID: 79876

UniProt ID: Q9GZZ9

Buffer: PBS and 1M Urea, pH 7.4.

Ensembl Gene ID: ENSG00000081307

More Information
SKU	ATLAPrEST96098-100
Manufacturer	Atlas Antibodies
Manufacturer SKU	APrEST96098-100
Green Labware	No
Package Unit	100 µl
Quantity Unit	STK
Human Gene ID	79876
Product information (PDF)	Download
MSDS (PDF)	Download