Skip to the beginning of the images gallery

PrEST Antigen UBR1

Name: PrEST Antigen UBR1
Brand: Atlas Antibodies
SKU: ATLAPrEST95926-100

ubiquitin protein ligase E3 component n-recognin 1

SKU

ATLAPrEST95926-100

Packaging Unit

100 µl

Manufacturer

Atlas Antibodies

Availability: loading...

Price is loading...

Product Details

More Information

GeneName: UBR1

Sequence: LHTTAIDKEGRRAVKAGAYAACQEAKEDIKSHSENVSQHPLHVEVLHSEIMAHQKFALRLGSWMNKIMSYSSDFR

Interspecies Mouse/Rat: ENSRNOG00000015813: 36%, ENSMUSG00000027272: 95%

Entrez Gene ID: 197131

UniProt ID: Q8IWV7

Buffer: PBS and 1M Urea, pH 7.4.

Ensembl Gene ID: ENSG00000159459

More Information
SKU	ATLAPrEST95926-100
Manufacturer	Atlas Antibodies
Manufacturer SKU	APrEST95926-100
Green Labware	No
Package Unit	100 µl
Quantity Unit	STK
Human Gene ID	197131
Product information (PDF)	Download
MSDS (PDF)	Download